Protein Info for mRNA_7777 in Rhodosporidium toruloides IFO0880

Name: 16145
Annotation: KOG0769 Predicted mitochondrial carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 86 to 111 (26 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details PF00153: Mito_carr" amino acids 5 to 119 (115 residues), 67 bits, see alignment E=5.8e-23 amino acids 125 to 210 (86 residues), 53.9 bits, see alignment E=6.9e-19 amino acids 215 to 309 (95 residues), 66.9 bits, see alignment E=6.2e-23

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>mRNA_7777 KOG0769 Predicted mitochondrial carrier protein (Rhodosporidium toruloides IFO0880)
MAPSLTPFGNAVVGAVGGVFSGAVVYPLDTIKTRIQTEHAAIEEAIANSTAPPSLKRSNA
PHHLPHRHATARQMALRIFKEGGALAFYRGFGANMLNTFSMQFAYFYFYTLVRSTYIKKF
PLRKMTTATELALGAIAAAMGQIFTIPVSVIATRQQLAKKTLSFRKAIAHILRDDGITGL
WRGLKPSLVLCVNPAITYGMFERLKTMLLKPGEKMTPFKAFLIGALSKTLATVVTYPYIM
AKTRLQAGNDDDDDTPPGQPKERYNGALDCLKQVYAEEGFTGWYQGMQAQITKAVLSQAL
LFGIKDALEAYTILSLVAYSKVRGSAVGLTSI