Protein Info for mRNA_7805 in Rhodosporidium toruloides IFO0880

Name: 16173
Annotation: K12389 BTS, CLN3 battenin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 359 to 382 (24 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 445 to 467 (23 residues), see Phobius details PF02487: CLN3" amino acids 32 to 473 (442 residues), 383.8 bits, see alignment E=5.6e-119

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>mRNA_7805 K12389 BTS, CLN3 battenin (Rhodosporidium toruloides IFO0880)
MQYPPMRSQLSPAQSTSGGVDRRTRNRLCWANFLFGTLNNIIYVVILSAALDLVDKASTP
KGIILLVNITPALLVKIGWPYFVPGPPRYGKRVAWCSGISFAGIIIVATSSTLLPRLFGI
ALASFSSGLGEMTFLQKATLYGSLSVPGGEDYGGTAVGWFSSGTGAAGIGGAGLWWVVRG
LGVRTGLLICSVLPLAMSATYFLLLPPLTAFRSHSPFSVTPSAQTYSALPADSSPDSDSA
DDEEELDEQHLKESVEKRLPALTTGEKIELARPLVRRYMVPLFLVYLAEYTINSGVAPTL
LYKVPTKEDAPVLALVIKSLRDYYPLWQLLYQTFVFVSRSSISILHIPPLPLRLLPLPTA
LQLVILSLTTLEASTSFVVAVLGEHGATWIVAGLICCEGLCGGAAYVNAFHRLATEEGRE
EGEDEEEEGFLGKDRLRREQEKEFRISAVGFADTGGILAASLVASFVEPRLCASQVARGR
LYCRQLD