Protein Info for mRNA_7813 in Rhodosporidium toruloides IFO0880

Name: 16181
Annotation: K01476 E3.5.3.1, rocF, arg arginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00491: Arginase
  • amino acids 17 to 315 (299 residues), 246.8 bits, E=1.7e-77
• TIGR01229: arginase
  • amino acids 20 to 321 (302 residues), 343.1 bits, E=7.1e-107

Best Hits

Swiss-Prot: 52% identical to ARGI_KLULA: Arginase (CAR1) from Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

KEGG orthology group: K01476, arginase [EC: 3.5.3.1] (inferred from 64% identity to scm:SCHCODRAFT_13992)

Predicted SEED Role

"Arginase (EC 3.5.3.1)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.1)

MetaCyc Pathways

• urea cycle (5/5 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-arginine degradation VI (arginase 2 pathway) (4/4 steps found)
• L-arginine degradation I (arginase pathway) (3/3 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• putrescine biosynthesis III (2/2 steps found)
• superpathway of putrescine biosynthesis (3/4 steps found)
• L-N^δ-acetylornithine biosynthesis (5/7 steps found)
• L-arginine degradation VII (arginase 3 pathway) (1/2 steps found)
• canavanine degradation (1/2 steps found)
• superpathway of polyamine biosynthesis I (5/8 steps found)
• superpathway of polyamine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.1

Protein Sequence (321 amino acids)

>mRNA_7813 K01476 E3.5.3.1, rocF, arg arginase (Rhodosporidium toruloides IFO0880)
MPLDAPTYTYKFLKSHTVGIVGCPFSGGQPRAGVDTGPLELIESGLVQDIEALGWKVDFA
GADTLVSPLVADGPDPDIGKLKKPRLVSNVNKQVAERVYKHAGAGELTVTLGGDHSLAMG
TVSGTFKAHPDAALIWIDAHADINTPLTTPSGNLHGCPVSFLMGLPGTSKEEIPEFGWIE
PVLKANRLVYIGLRDIDEGERKILKENNIKSFTMHHVDRYGIGKVVDMALDHVGRDRPIH
LSFDVDAFDPAVAPSTGTAVRGGLQWREGLCAVEMIAETGNLVSLDIMEINPSISSTDND
VKQTVDVGRALVRAALGETLL