Protein Info for mRNA_7823 in Rhodosporidium toruloides IFO0880

Name: 16191
Annotation: K03011 RPB3, POLR2C DNA-directed RNA polymerase II subunit RPB3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF01193: RNA_pol_L" amino acids 26 to 266 (241 residues), 48.2 bits, see alignment E=5.9e-17 PF01000: RNA_pol_A_bac" amino acids 55 to 183 (129 residues), 102 bits, see alignment E=2.7e-33

Best Hits

Predicted SEED Role

"DNA-directed RNA polymerase II 45 kDa polypeptide (EC 2.7.7.6)" in subsystem RNA polymerase II (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>mRNA_7823 K03011 RPB3, POLR2C DNA-directed RNA polymerase II subunit RPB3 (Rhodosporidium toruloides IFO0880)
MQPPATYDGADLRVKITELKGDRCHFILDGVHLGLANSLRRSMISRIDTLAIDQVQIHEN
SSVLPDEMLAHRLGMVPLNSEGMEKQILNYNKECDCDQYCPKCSVVLTLSAKCVSSSTME
VTTKDLLLEGGISDVGKPATSALRHPDPKLQDGILLAKLAKGQEINLRCIAVKGRALEHA
KWSPVAAVGFEYDPYNKLKHTDLWFEVGTDPKDEWPVSENGKYEKKPEDTDPFPYNEKPS
RFYYDVEAVGQLKPEEIVTKGLDALILQMGQLRQGLLDLTNQGGPGPMHPGDGGQDGMMM
DAGPVFGVGDGGYAGAPATAGAYGGAPGYGGGGGYGGATPGGMGGQGYGPPPVPAYGASP
AHFANQGGAGGYGQPGGGRTPGYGGANGAQGGGGGGGGWGDDPW