Protein Info for mRNA_7829 in Rhodosporidium toruloides IFO0880

Name: 16197
Annotation: K06126 COQ6 ubiquinone biosynthesis monooxygenase Coq6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF01494: FAD_binding_3" amino acids 216 to 335 (120 residues), 23.8 bits, see alignment E=1.3e-09 amino acids 466 to 503 (38 residues), 32.7 bits, see alignment 2.5e-12

Best Hits

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>mRNA_7829 K06126 COQ6 ubiquinone biosynthesis monooxygenase Coq6 (Rhodosporidium toruloides IFO0880)
MLATTSRALARTCTAARTRPSPRQLTRSLGWFARATESPSSLADEQPPPSTVAEEEHDLV
IVGGGPAGLTLAAALASSPAVARTHSITLIEGGSLDGVKGWAPKGGEEWSNRVSSITAEN
AANLAQAGIWQHLDETRTCPITGLQVWDGLSSSRITFDSPAISPSSTETSWDEAYASALS
GPRRKPMSTMVENLNLQRAAWRRIEELQRGEKVKRVEVLDRTRVEGIERGERGGWPVVSL
RAADGKERKLRARLLIGADGASSPVKSYSKIDSFGWPYDRHGVVATLSIDAEAAELGMGT
TRNAMSTMWQRFLPEGPVAFLPLSNKDASMVWSTTPAYASLIKSLPLEVLPNLIAAAFAL
PHDQLKTFLDSFIAPSTSSAPPPAKRDFDAAAINAQLEALLVRHSQSTYDPSTPSDPLPP
PILAVQPSSVASFPLRLSHTSSYLGLPSPLPSTTTSPDGTIAVDLRTVLVGDAAHTVHPL
AGQGLNLGLLDAFSLSSLLSTLAQQGTDLGSYIALKPYPRDRYFANHKILSACDHLESLF
RRTNAPVVWARSTGIGVLDAMEPLKEVLMAQAGSVKTSDGRGGARSAGAWGAVASVLDNV
GKAREVVGLVGGAVVGQIGRRAAEFIVKGR