Protein Info for mRNA_7834 in Rhodosporidium toruloides IFO0880

Name: 16202
Annotation: HMMPfam-Sulfate transporter family-PF00916,HMMPfam-STAS domain-PF01740,HMMPfam-Sulfate transporter N-terminal domain with GLY motif-PF13792,ProSiteProfiles-STAS domain profile.-PS50801,SUPERFAMILY--SSF52091

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 transmembrane" amino acids 136 to 151 (16 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details amino acids 472 to 492 (21 residues), see Phobius details amino acids 498 to 515 (18 residues), see Phobius details amino acids 535 to 564 (30 residues), see Phobius details PF00916: Sulfate_transp" amino acids 132 to 523 (392 residues), 273.9 bits, see alignment E=1.9e-85 PF01740: STAS" amino acids 603 to 722 (120 residues), 48.3 bits, see alignment E=7.2e-17

Best Hits

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (747 amino acids)

>mRNA_7834 HMMPfam-Sulfate transporter family-PF00916,HMMPfam-STAS domain-PF01740,HMMPfam-Sulfate transporter N-terminal domain with GLY motif-PF13792,ProSiteProfiles-STAS domain profile.-PS50801,SUPERFAMILY--SSF52091 (Rhodosporidium toruloides IFO0880)
MSRPPSRVTNRPVTESPSRTGERQPLLGSPPPPSSRVRKTKTEPTRLGQTRTDSESDSRS
PGEGRRPGSMTPQSRMEVAFATLPERLSRAAEQAQKRERVEEDLTRWQLLYRRARYYIPV
LQWLPHYSLKSFMRDVVAALTLTSLIAPQSMSYATNLVHTDPVHGLFGAAVPAMIYSAMG
TCRQLSVGPEAALSLITGETIAKFIEEEEHAHGRMSDAHRVKFIAKIITVITFESGLVTF
LLGFFRLGFLDAVLSRALLRGFMTAVAVTIFVSQAASILGIEAGLNAAYGASSSVLEKVQ
YIATHLGETHRLTLLVSIIALAALIGGKIGKRTVAQKKGYWRIALYVPEVLLVVVLSTVL
SHIFHWNHAGLSVLGRVSPGDVKVRVPFVGWGYMRRYITKSFGTSTVIAILGFLDSIVAA
KDMASKHDYPISPNRELCALGSANLFAAFCTGSLPGYGSITRSRLASVTGATTQMSSLLT
GTFVLLVTYFLLRFLGPLPKCILAVIVCVVVFSIFEETPEDVKFFYKMGSWTDGGLMLLT
FALSLFVSVEVGIITSVALSMLLCIKHSTAMRLNILGRVPGTSTFEPLEEDLNDDGLLPV
MGEEVPGVLIVKIRDVALTFANTGYLKERLRRLERYGHGRHHPAEEPRREEASVVIFDLT
DVSEVDASALQIMLELVDSYAARNVLIYWTQCNPRAFARLREAGVVDKSGGDAHVQPSVA
RALEEIHQTMLQVNGGSGAGGADASSI