Protein Info for mRNA_7845 in Rhodosporidium toruloides IFO0880

Name: 16213
Annotation: K14154 THI6 thiamine-phosphate diphosphorylase / hydroxyethylthiazole kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 472 to 489 (18 residues), see Phobius details amino acids 496 to 515 (20 residues), see Phobius details PF02581: TMP-TENI" amino acids 26 to 176 (151 residues), 151.9 bits, see alignment E=1.9e-48 TIGR00693: thiamine-phosphate diphosphorylase" amino acids 28 to 253 (226 residues), 160 bits, see alignment E=2.2e-51 PF02110: HK" amino acids 293 to 538 (246 residues), 244.7 bits, see alignment E=1.4e-76

Best Hits

Predicted SEED Role

"Hydroxyethylthiazole kinase (EC 2.7.1.50)" in subsystem Thiamin biosynthesis (EC 2.7.1.50)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>mRNA_7845 K14154 THI6 thiamine-phosphate diphosphorylase / hydroxyethylthiazole kinase (Rhodosporidium toruloides IFO0880)
MPNFSLYYVTGRSLLPPPPSSYTGPKEDYYLAHLEQALKGGVTVVQVREKDVDGAEFLEV
ARRTKEVCDKYDVPLFINDRVDVALALKCHCHVGQTDLPARLVRQLLGPDALIGVSVNTP
EEMQVVMDEGVADYVGVGPCFGTQTKKNLNPILGPRGVRAVLETLGESEIKAVIIGESIV
LSACFRIRRIRRIRRAGRSGCTLAGGITPSTIPNVLAQTPAPLPSGGYRALDGLAVVSAI
AASTEPETAARELREMFDRKPAYPSRLLDPGELSADHVVEQAVELLRILKDGEKTPLVHH
ITNFVVMNDTANLTLAFGASPIMSASPDEAPHLSQLISCLLLNLGTITEAQLNAQKIAGA
AANKNRKPVVFDPVGVGATEYRKKSASDLLNTCHVSIIKGNAGEIGALSGLSEVKARGVD
SVGKGFKDPATVVKTLAAREKLVVAMSGETDYISDGQVSFTIKNGTFWQEKITGSGCMAS
AAVALFAGLQHESGPFIAAIAGLLAINVAAEIAAARPEVNGPNTFRAALIDACYNLRPED
VRSRAKVQRV