Protein Info for mRNA_7885 in Rhodosporidium toruloides IFO0880

Name: 16253
Annotation: KOG0137 Very-long-chain acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF00173: Cyt-b5" amino acids 7 to 79 (73 residues), 64.7 bits, see alignment E=1.7e-21 PF02771: Acyl-CoA_dh_N" amino acids 120 to 245 (126 residues), 46.3 bits, see alignment E=1.6e-15 PF02770: Acyl-CoA_dh_M" amino acids 250 to 340 (91 residues), 60.1 bits, see alignment E=4.9e-20 PF00441: Acyl-CoA_dh_1" amino acids 354 to 509 (156 residues), 95.4 bits, see alignment E=9.9e-31 PF08028: Acyl-CoA_dh_2" amino acids 383 to 476 (94 residues), 25.1 bits, see alignment E=4.8e-09

Best Hits

KEGG orthology group: None (inferred from 55% identity to scm:SCHCODRAFT_61211)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>mRNA_7885 KOG0137 Very-long-chain acyl-CoA dehydrogenase (Rhodosporidium toruloides IFO0880)
MAARTFSLEQISEHNKEGDLWIVVNGDVYDLSRFTDIHPGGAGVLLASDIAGKDASEAFF
SLHRSSVLAKYKRLIIGKLDSDASASSTKYVLPLDGELSPVPYAEPSWLVPSYKSPYFKD
SHRRLQKAMRKFFDENVKAEAREFELSGERPTQKLVELMGTDEWNIHAMRMGPGRHLHGK
TLPGNVKGEEFDYFHELVCVQEMCRVGAPGYMAGLQAGMVIGLPPILNFAPEPLRQRILP
DILAGKKFISLAISEPHAGSDVQGITTSATLSEDGKYWIVSGMKKWITNGHFSDYFMTAV
RTGPKSLTMMLIERDADTVDTRKIKTSYSPSAGTAYVFFEKTKVPVENVLGGEGNGLKVI
LSNFNHERWVINCRIARYSRLVFEETWKWAHLRKSQGKRLIDNAVVRQKFGQMIARIDSG
QAWLEHLTYQMTKMTYAEQSAQLAGPMALNKYYLARCGQEISDMAVQIWGGRGITQGGMG
ALIEQYQRTYKFDNVLGGADEVLADLGVRQASKRMPKAVL