Protein Info for mRNA_7896 in Rhodosporidium toruloides IFO0880

Name: 16264
Annotation: K01783 rpe, RPE ribulose-phosphate 3-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00834: Ribul_P_3_epim
  • amino acids 10 to 205 (196 residues), 200.2 bits, E=1.3e-63

Best Hits

Swiss-Prot: 53% identical to RPE_ASHGO: Ribulose-phosphate 3-epimerase (RPE1) from Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 64% identity to cci:CC1G_10281)

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

• Bifidobacterium shunt (14/15 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• heterolactic fermentation (11/18 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.1

Protein Sequence (237 amino acids)

>mRNA_7896 K01783 rpe, RPE ribulose-phosphate 3-epimerase (Rhodosporidium toruloides IFO0880)
MSPSSPRAIVSPSVLASNFAQLGDEIRRMMKCGAEWVHMDVMDGHFVPNITMGAPVLASV
DKDVKDVFMDCHMMVSDPEKWVKPVAEAGGKSYTFHIEALADPSPELVDLIHSHSMRAAV
AISPSTPSSAISTSLGQKVDMLLVMTVVPGAGGQKFMKECVPKVSELRERFPEKDIQVDG
GVGPGTVGCCARAGSNVIVAGTALFGASDPKSVIDDFKKQVDEGKSVWGTEKALEGL