Protein Info for mRNA_7898 in Rhodosporidium toruloides IFO0880

Name: 16266
Annotation: K12660 rhmA 2-dehydro-3-deoxy-L-rhamnonate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 19 to 241 (223 residues), 124 bits, E=2.7e-40

Best Hits

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 63% identity to cnb:CNBD4290)

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Lysine degradation
• Naphthalene and anthracene degradation
• Pentose phosphate pathway
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.- or 4.1.2.n4

Protein Sequence (253 amino acids)

>mRNA_7898 K12660 rhmA 2-dehydro-3-deoxy-L-rhamnonate aldolase (Rhodosporidium toruloides IFO0880)
MDKRLFLRNALRQNKPAVGMWLTMPGTALARTIATVPGLNWILIDGEHGLVTDRDFYELN
NTISSCGVSLIIRIPYAEGWLIKRALDSGAQGLMVPMIHTAELARSVVSLSKFAPQGIRG
CGSPFTHHAFGVDAAEYEAKANDSLLTILQIESREGLENIEEIAAVPGVDVIFIGPFDLA
KSMDVKFGGDEHQKAISTILEATKAAKKHAAIFCATGDQARERLQQGFDMVSVSTDTHSL
ARDLSAQLAVLKK