Protein Info for mRNA_7962 in Rhodosporidium toruloides IFO0880

Name: 16330
Annotation: K08967 mtnD, mtnZ, ADI1 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF03079: ARD" amino acids 2 to 151 (150 residues), 145.6 bits, see alignment E=2.3e-46 PF02311: AraC_binding" amino acids 78 to 135 (58 residues), 23.5 bits, see alignment E=6.8e-09 PF07883: Cupin_2" amino acids 79 to 134 (56 residues), 32.5 bits, see alignment E=8.7e-12

Best Hits

Swiss-Prot: 62% identical to MTND1_COPC7: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 (ADI1-1) from Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)

KEGG orthology group: K08967, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC: 1.13.11.53 1.13.11.54] (inferred from 62% identity to cci:CC1G_11132)

Predicted SEED Role

"1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54)" in subsystem Methionine Salvage (EC 1.13.11.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.53 or 1.13.11.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>mRNA_7962 K08967 mtnD, mtnZ, ADI1 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (Rhodosporidium toruloides IFO0880)
MKAYIYDDKPGDQREPHDSGEEVSVDQLKAIGVLPYPGIELDQVEEIAKSRGYKNRDEIN
VSKAGLGDVYEEKIKGFFREHLHEDEEIRYIKDGRGYFDIREAGDKRWIRIAVEPKDLLI
VPAGVYHRFTLDSGDYIKAMRLFQDEPKWIPHDKNEATDKNPFREQYLQSIKA