Protein Info for mRNA_7962 in Rhodosporidium toruloides IFO0880

Name: 16330
Annotation: K08967 mtnD, mtnZ, ADI1 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03079: ARD
  • amino acids 2 to 151 (150 residues), 145.6 bits, E=2.3e-46
• PF02311: AraC_binding
  • amino acids 78 to 135 (58 residues), 23.5 bits, E=6.8e-09
• PF07883: Cupin_2
  • amino acids 79 to 134 (56 residues), 32.5 bits, E=8.7e-12

Best Hits

Swiss-Prot: 62% identical to MTND1_COPC7: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 (ADI1-1) from Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)

KEGG orthology group: K08967, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC: 1.13.11.53 1.13.11.54] (inferred from 62% identity to cci:CC1G_11132)

Predicted SEED Role

"1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54)" in subsystem Methionine Salvage (EC 1.13.11.54)

MetaCyc Pathways

• 3-methylthiopropanoate biosynthesis (1/1 steps found)
• L-methionine salvage cycle III (7/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (3/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.53 or 1.13.11.54

Protein Sequence (173 amino acids)

>mRNA_7962 K08967 mtnD, mtnZ, ADI1 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (Rhodosporidium toruloides IFO0880)
MKAYIYDDKPGDQREPHDSGEEVSVDQLKAIGVLPYPGIELDQVEEIAKSRGYKNRDEIN
VSKAGLGDVYEEKIKGFFREHLHEDEEIRYIKDGRGYFDIREAGDKRWIRIAVEPKDLLI
VPAGVYHRFTLDSGDYIKAMRLFQDEPKWIPHDKNEATDKNPFREQYLQSIKA