Protein Info for mRNA_7981 in Rhodosporidium toruloides IFO0880

Name: 16349
Annotation: KOG2504 Monocarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 87 to 110 (24 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 286 to 313 (28 residues), see Phobius details amino acids 326 to 350 (25 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details amino acids 413 to 432 (20 residues), see Phobius details amino acids 439 to 459 (21 residues), see Phobius details PF07690: MFS_1" amino acids 90 to 398 (309 residues), 49.1 bits, see alignment E=2.1e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>mRNA_7981 KOG2504 Monocarboxylate transporter (Rhodosporidium toruloides IFO0880)
MSRQPIELDTITPVPPSPAYSRPSTPPSLKPRTSSYPPSEILQSVGNGVSTREPTRQSSL
RNLNLEQGEGTAVSLPPTDRGRGAWEFALAAFILECWGYSYSFATILVYLQSTPPWSSSS
LSAISAIGSCQIGIQFCLSPLVVIVFRRYPDWVKTSLWVSLVVSCGSMLLSSWATKVWQL
ITLQGVMCGATGAILYTPVWIWLIEWFVERRGLAGGIIWSGTGIGGFIFPFLFSGLLSKV
GFAWMVRVWSLITAVVFAFAVYIVKPRIPPPRIRKGDRGPWPAFPWKVLIDPMFVGMALA
SLFASLSTFPVSLYLATYASSLTTSAFAAEIVVGIYNIAASVGCTALGYVSDWSYTGATI
LCGVLGTIIALFAWGWADTLAKTYGFAVLFGFSSQMIVAWSGATRDVAGQDPYAAALVYC
LLSVKGDATSWGRFGFSRMIVFVGVTSFVSAIAGVALEFMRRKYKKA