Protein Info for mRNA_7982 in Rhodosporidium toruloides IFO0880

Name: 16350
Annotation: KOG2504 Monocarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 88 to 112 (25 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details amino acids 329 to 352 (24 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 385 to 404 (20 residues), see Phobius details amino acids 415 to 438 (24 residues), see Phobius details amino acids 462 to 482 (21 residues), see Phobius details PF07690: MFS_1" amino acids 156 to 435 (280 residues), 61.4 bits, see alignment E=3.9e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>mRNA_7982 KOG2504 Monocarboxylate transporter (Rhodosporidium toruloides IFO0880)
MTRPVEPIELDTITPAPPSPAHSRPATPSSLKAPTSSYPPSEILPSNGNGFSTTETTRQS
SLRSLNLEYGEGTAVSLPPMDRGRGAWQFVVAAFILECWGYSYSFATILVYLQSTPPWSS
SSLSALSAIGSCQLGIQFCLPIAIVIVFRRYPDWVKTSLWVSLVVNCGSMLLSSWATKVW
QLIVLQGVVCGTAGAILYAPVLIWLTEWFHERRGLAGGIIWSGTGIGGFLFPFLISGLLS
KVGFAWMIRVWSLLTAVVFAFSLYIVKPRIPPPRVRKGERGPWPAFPWKVLIDPVFVTMA
IASLFASLSTFPVSLYLATYASSLTTSTFVAEIVVGIYNVAASVGCTVLGYVSDWSYTAA
TILCGVLGTIIALFAWGWADTLAKTYGFAVLFGFSSQMIVAWSGATRDVAGQDPYAAAIT
FCLLSSVRGIASIVMPLVSQGLYNPKLKNDATSWGRFGFEKMIVFVGVTAFVSAIAGVAL
EYMRRKHKKA