Protein Info for mRNA_8017 in Rhodosporidium toruloides IFO0880

Name: 16385
Annotation: K11087 SNRPD1, SMD1 small nuclear ribonucleoprotein D1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF01423: LSM" amino acids 2 to 62 (61 residues), 64.6 bits, see alignment E=2.6e-22

Best Hits

Swiss-Prot: 76% identical to SMD1_MOUSE: Small nuclear ribonucleoprotein Sm D1 (Snrpd1) from Mus musculus

KEGG orthology group: K11087, small nuclear ribonucleoprotein D1 (inferred from 79% identity to bfo:BRAFLDRAFT_264344)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>mRNA_8017 K11087 SNRPD1, SMD1 small nuclear ribonucleoprotein D1 (Rhodosporidium toruloides IFO0880)
MKLNNETVTIELKNGTSVHGTITGVDPSMNTHLKKVKMTVRGREPQALDSLAIRGNNVRY
FILPDSLPLDTLLIDDAPKPKKKKGEATRGRGRGQDRGRGRGRGRGGRGRGI