Protein Info for mRNA_8029 in Rhodosporidium toruloides IFO0880

Name: 16397
Annotation: K02152 ATPeV1G, ATP6G V-type H+-transporting ATPase subunit G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01147: V-type ATPase, G subunit
  • amino acids 1 to 113 (113 residues), 121.6 bits, E=1.2e-39
• PF03179: V-ATPase_G
  • amino acids 4 to 106 (103 residues), 117.9 bits, E=1.5e-38

Best Hits

Swiss-Prot: 48% identical to VATG_NEUCR: V-type proton ATPase subunit G (vma-10) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K02152, V-type H+-transporting ATPase subunit G [EC: 3.6.3.14] (inferred from 56% identity to uma:UM04345.1)

MetaCyc: 40% identical to H+-translocating V-ATPase subunit G2 (Homo sapiens)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (118 amino acids)

>mRNA_8029 K02152 ATPeV1G, ATP6G V-type H+-transporting ATPase subunit G (Rhodosporidium toruloides IFO0880)
MAANSQGIATLLDAEKEASQIVAKAREYRNQRLKDARGEASKEIEQLRAKKEADFKEFEN
QHSGDSSSSQDEVNKATQEALAKIEASFEENREKVVKDLLERVVQVNPALHRNLEARS