Protein Info for mRNA_8051 in Rhodosporidium toruloides IFO0880

Name: 16419
Annotation: K02958 RP-S15e, RPS15 small subunit ribosomal protein S15e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR01025: ribosomal protein uS19" amino acids 16 to 149 (134 residues), 203.7 bits, see alignment E=4.4e-65 PF00203: Ribosomal_S19" amino acids 47 to 132 (86 residues), 115.9 bits, see alignment E=3.2e-38

Best Hits

Swiss-Prot: 77% identical to RS15_PODAS: 40S ribosomal protein S15 (RPS15) from Podospora anserina

KEGG orthology group: K02958, small subunit ribosomal protein S15e (inferred from 82% identity to tml:GSTUM_00004708001)

Predicted SEED Role

"SSU ribosomal protein S15e (S19p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>mRNA_8051 K02958 RP-S15e, RPS15 small subunit ribosomal protein S15e (Rhodosporidium toruloides IFO0880)
MNADEAAAERRKARTFKKFSYRGVELAQLLDLDSAAFTELVHARARRRFQRGLKRKPLAL
MKKLRKAKTEAQPNEKPAVVKTHLRDMIIVPEMIGSVVGIYNGKVFNSVEIKPEMVGFYL
GEFSITYKPVRHGRPGIGATHSSRFIPLK