Protein Info for mRNA_8054 in Rhodosporidium toruloides IFO0880

Name: 16422
Annotation: K03036 PSMD11, RPN6 26S proteasome regulatory subunit N6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF18055: RPN6_N" amino acids 8 to 99 (92 residues), 125.3 bits, see alignment E=2.4e-40 PF01399: PCI" amino acids 255 to 356 (102 residues), 64.7 bits, see alignment E=1.6e-21 PF18503: RPN6_C_helix" amino acids 362 to 387 (26 residues), 42.9 bits, see alignment (E = 4.8e-15)

Best Hits

Swiss-Prot: 60% identical to PSD11_MOUSE: 26S proteasome non-ATPase regulatory subunit 11 (Psmd11) from Mus musculus

KEGG orthology group: K03036, 26S proteasome regulatory subunit N6 (inferred from 70% identity to uma:UM02684.1)

Predicted SEED Role

"proteasome regulatory subunit Rpn6" in subsystem Proteasome eukaryotic

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>mRNA_8054 K03036 PSMD11, RPN6 26S proteasome regulatory subunit N6 (Rhodosporidium toruloides IFO0880)
MAHAAGPRDDELLRDKEQAILKLGELYRDEKNADALAEVLKSSRPLVEHMAKAKTAKLIR
NLLDFFADIPGSTQVQIDAVKESAEWAKSEKRIFLKQNLETRLVALYIDNQNYKDALSLI
NSLLRELKKLDDKMILTEVHLLESRVNHALANMPKAKAALTSARTAANAIYCPPLLQASL
DMQSGVLHAEDKDYKTAYSYFFEAFEGYSGQDDPKAVPALKYMLLCKIMLNLAEDVKSIV
AGKSAQRYAGPDVEAMKAVAKAHEERSLQDFERELKDRKKELSDDPIIRNHLAALYDTLL
EQNLVRIIEPYSRVEIKHVAEMVKQPVRDVEIKLSQMILDKVFHGILDQGAGCLIVFDEP
EVDATYEATLETIGHVRDVVDQLFQRTRTAVI