Protein Info for mRNA_8072 in Rhodosporidium toruloides IFO0880

Name: 16440
Annotation: K14684 SLC25A23S solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 63 to 81 (19 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details PF00153: Mito_carr" amino acids 61 to 149 (89 residues), 83.9 bits, see alignment E=3.1e-28 amino acids 157 to 254 (98 residues), 68.6 bits, see alignment E=1.9e-23 amino acids 263 to 355 (93 residues), 84.7 bits, see alignment E=1.7e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>mRNA_8072 K14684 SLC25A23S solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41 (Rhodosporidium toruloides IFO0880)
MAAALATTASHPEHPPVVDQRSGMPGSLSPQTAVSAVARPTPPPTYVLSWTPNAPWRHIP
LPPASAFIAGALAGAASRTVVSPLERLKILLQVQGASAQYKGVWHGLTKMWREEGFKGYM
RGNGINVLRIAPYSAVQFSSYELFKSALRGEDGSMDTPRRLTAGSLAGICSVVSTYPLDL
VRSRLSVESASLGMKEGRTDGRSTGIVRMTLKVMREEGGVKALYRGLVPTSAGVAPYVAF
NFASYELLKIQLMDHTSDHHEPGTFAKLLCGGVAGAVSQTLTYPADLLRRRMQMVGLKSQ
ALGYEYTGAWNAVFSIIRQDGIKGLYRGLWPNLLKCAPSIGVSFAVYEWTKETLDDYFDD
EHDEAADSSEA