Protein Info for mRNA_8115 in Rhodosporidium toruloides IFO0880

Name: 16483
Annotation: K03868 RBX1, ROC1 RING-box protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12861: zf-ANAPC11
  • amino acids 15 to 97 (83 residues), 65.7 bits, E=4.9e-22
• PF12678: zf-rbx1
  • amino acids 33 to 91 (59 residues), 87.8 bits, E=7.1e-29

Best Hits

Swiss-Prot: 93% identical to RBX1_SALSA: RING-box protein 1 (rbx1) from Salmo salar

KEGG orthology group: K03868, RING-box protein 1 (inferred from 93% identity to ecb:100055581)

MetaCyc: 93% identical to RING-type E3 ubiquitin transferase RBX1 (Homo sapiens)
RXN-18740 [EC: 2.3.2.32]; RXN-15561 [EC: 2.3.2.32, 2.3.2.27]

Predicted SEED Role

No annotation

MetaCyc Pathways

• protein NEDDylation (3/3 steps found)
• protein ubiquitination (3/9 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.27 or 2.3.2.32

Protein Sequence (101 amino acids)

>mRNA_8115 K03868 RBX1, ROC1 RING-box protein 1 (Rhodosporidium toruloides IFO0880)
MADVEMKPQDAPKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQGSAANDE
CTVAWGVCNHAFHFHCINRWLKTRQVCPLDNREWELQKYGK