Protein Info for mRNA_8197 in Rhodosporidium toruloides IFO0880

Name: 16565
Annotation: KOG2922 Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 379 to 397 (19 residues), see Phobius details PF05653: Mg_trans_NIPA" amino acids 14 to 168 (155 residues), 34.5 bits, see alignment E=6.2e-13 amino acids 290 to 395 (106 residues), 48.3 bits, see alignment E=4.1e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (572 amino acids)

>mRNA_8197 KOG2922 Uncharacterized conserved protein (Rhodosporidium toruloides IFO0880)
MMGEEAGPHISIAAGITVGLVSSFVQSLGLTVQRLSHLSNEKLPADERRRDWQRPLWLAG
FAVFIISNVFGTLFQLGALPIVVLGPLGAVSLLWNAFFARIILGDHFSAQLVAGSILIAG
GATLIGIFGVVPEPTLSLPRLTALYTRPAFLLFLLFLALGLLLTLFVAHLAEWRLNKRLE
NLHLPPGTPKTPRAVSRAVRKRRWSMPPADAGRSTAQPVSGERQPLLPKHAVPPPAVSPD
RATKPRPPSLRFDDPKLGFVSLDETMQGIERTRVWLATAYGATSGTLAGLCLLFTKTGVD
LVILTIQGKNQFNRIEAWLILAVLLICELFQLAYLNRALRLSGPTFVCPLSFCFYNTASI
VSGIIYYRQADALSRLQGGMVGLGCTVLLAGVWVVSLKSGAPKGDEKDEVGGGWADEPEE
LAMEGVEDLTDEDEPVIWRPRGFSIGLSAASPGFEIRPRPARAQTAGLPTSSPFSTSSED
SLARSTASLPPNTPRTSRPARGHRRSESLSGALYVGEANEDVWRTASSADRATGDGLGIQ
GAATEASGPETDRTREKWVARWRRRLRMSVES