Protein Info for mRNA_8202 in Rhodosporidium toruloides IFO0880

Name: 16570
Annotation: K03283 HSPA1_8 heat shock 70kDa protein 1/8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 PF00012: HSP70" amino acids 23 to 619 (597 residues), 772.3 bits, see alignment E=2.9e-236 PF06723: MreB_Mbl" amino acids 140 to 395 (256 residues), 52.3 bits, see alignment E=4e-18

Best Hits

Swiss-Prot: 71% identical to SSB2_YEAST: Ribosome-associated molecular chaperone SSB2 (SSB2) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K03283, heat shock 70kDa protein 1/8 (inferred from 81% identity to scm:SCHCODRAFT_65817)

Predicted SEED Role

"Chaperone protein DnaK" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>mRNA_8202 K03283 HSPA1_8 heat shock 70kDa protein 1/8 (Rhodosporidium toruloides IFO0880)
MSAEDEIPQLVEGNAADDVFEGAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVA
FTESERLIGDSAKNQAAMNPKQTVFDAKRLIGRRFDDAEVKKDMTHWPFTVIDKDGSPFI
EVNYLGETKSFSPAEISAMVLSKLKETAEAKIGKEVKKAVITVPAYFNDSQRLSTKDAGT
IAGLDVLRIINEPTAAAIAYGLGEATEKSKKEKIVLIFDLGGGTFDVSLLSITGGVFAVK
ATAGDTHLGGEDFDNTLLEHFKKEFERKTKLDISGDARALRRLRSACERAKRTLSSVTQT
TVEVDSLFQGQDFSASISRARFEEINAATFRSTLDPVERVLKDAKIDKSKVDDIVLVGGS
TRIPKIQSLVSEFFGGRQLNKSINPDEAVAYGAAVQAAVLTGQTSEKTADLLLLDVAPLS
LGVAMQGDVFGVVVPRNTPIPCNKSRTFTTVEDNQTTVTFPVYEGERVTCKENRLLGEFE
LSGITPQPRGQAELVCTFEIDANGLLKVSALDRTSGRRANITISNSVGRLSSSEIDQMIK
DAEQYKQADKDFSAKHEARQELESYVASVEATLQSPEASKIKRHNRSALEAELSKALERL
EIEDSSADELRRANLHLKRGMQKALAGGR