Protein Info for mRNA_8232 in Rhodosporidium toruloides IFO0880

Name: 16600
Annotation: K12623 LSM4 U6 snRNA-associated Sm-like protein LSm4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details PF01423: LSM" amino acids 6 to 70 (65 residues), 60.8 bits, see alignment E=4.1e-21

Best Hits

Swiss-Prot: 55% identical to LSM4_ORYSJ: Probable U6 snRNA-associated Sm-like protein LSm4 (Os01g0256900) from Oryza sativa subsp. japonica

KEGG orthology group: K12623, U6 snRNA-associated Sm-like protein LSm4 (inferred from 64% identity to cnb:CNBC2050)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>mRNA_8232 K12623 LSM4 U6 snRNA-associated Sm-like protein LSm4 (Rhodosporidium toruloides IFO0880)
MLPLALLHAAQAKPMLVELKNGETFNGHLVACDNFMNVTLKEVYQTSADGERFWKLPEAY
IRGNNIKYIRVAENLVDQVKEQEEEQRRRGNSGRGGPGGGRGGGMGRGGGMGGRGGRGGA
PGRGGRGGAPGRGGMRGGAKIGGP