Protein Info for mRNA_8250 in Rhodosporidium toruloides IFO0880

Name: 16618
Annotation: K17069 MET17 O-acetylhomoserine/O-acetylserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01326: O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
  • amino acids 9 to 431 (423 residues), 661.2 bits, E=2.8e-203
• PF01053: Cys_Met_Meta_PP
  • amino acids 10 to 431 (422 residues), 487.9 bits, E=3.9e-150
• PF06838: Met_gamma_lyase
  • amino acids 47 to 234 (188 residues), 25.7 bits, E=1e-09
• PF01041: DegT_DnrJ_EryC1
  • amino acids 55 to 190 (136 residues), 28.6 bits, E=2.3e-10
• PF00155: Aminotran_1_2
  • amino acids 66 to 224 (159 residues), 41.3 bits, E=3e-14
• PF00266: Aminotran_5
  • amino acids 86 to 217 (132 residues), 38.9 bits, E=1.4e-13

Best Hits

Swiss-Prot: 65% identical to CYSD_EMENI: Homocysteine synthase (cysD) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K01740, O-acetylhomoserine (thiol)-lyase [EC: 2.5.1.49] (inferred from 68% identity to pan:PODANSg6532)

MetaCyc: 52% identical to O-acetylhomoserine sulfhydrylase (Leptospira meyeri)
O-acetylhomoserine aminocarboxypropyltransferase. [EC: 2.5.1.49]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• L-methionine biosynthesis I (3/5 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (10/15 steps found)
• L-cysteine biosynthesis VI (from L-methionine) (3/6 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (10/18 steps found)
• aspartate superpathway (15/25 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48

Use Curated BLAST to search for 2.5.1.48 or 2.5.1.49

Protein Sequence (435 amino acids)

>mRNA_8250 K17069 MET17 O-acetylhomoserine/O-acetylserine sulfhydrylase (Rhodosporidium toruloides IFO0880)
MATNPDWRPETLALHAGYEEADAATKARAVPIYQTTSFVFNNSEHAANLFGVTFGNVYSR
IGNPTVEVFEKRIAALERGVAAVATSSGQAAQFQAIAALAQAGDNIVSTTSLYGGTYNQF
KVLLKRFGIEVRFVNSDDPGEFDKLLDDKTKAIYIESIGNPKYNIPDIARIAEVAHKAGV
VLIVDNTFGAGGAIARPFDHGADIIVHSATKWIGGHGNSIGGVIIDGGKFDWSQSKRYTD
FTEPSEGYHGLKFAETFGNLAFAVKVRVEVLRDLGACLSPFNAFLLLQGLETLSLRVERH
TQNALALAKWLEANPAVEWVSYPGLPSHPYHQQALKTLQKDRYGAVLSFGVKGDAKDGKR
GSLVVDSLVLASNLANVGDAKTLVIHPASTTHQQLSTEEQLASGVSPDLIRVSVGIEHID
DIIADFEQAFKKTAL