Protein Info for mRNA_8276 in Rhodosporidium toruloides IFO0880

Name: 16644
Annotation: K06630 YWHAE 14-3-3 protein epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00244: 14-3-3
  • amino acids 15 to 237 (223 residues), 357.5 bits, E=1.3e-111

Best Hits

Swiss-Prot: 80% identical to ARTA_ASPFN: 14-3-3 family protein artA (artA) from Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167)

KEGG orthology group: K06630, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein (inferred from 76% identity to ang:ANI_1_962064)

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• glycerol degradation to butanol (11/16 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (10/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.1

Use Curated BLAST to search for 5.3.1.1

Protein Sequence (266 amino acids)

>mRNA_8276 K06630 YWHAE 14-3-3 protein epsilon (Rhodosporidium toruloides IFO0880)
MAAEGSSSREAHVYMARISEQAERYDEMVNEMKEVAKLGVELTVEERNLLSVSYKNVIGA
RRASWRIISSIEQKEEAKGNSSQVSKIKAYREKVEGELSDVCNDILDVLDKHLIPAAQSG
ESKVFYHKMKGDYHRYLAEFAAGDQRQKASDAAHEAYKTASEIATSELAPTHPIRLGLAL
NFSVFYYEILNSPEKACHLAKTAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDL
SAEEPAQQEAPKAEEEAKPVAGEEAA