Protein Info for mRNA_8311 in Rhodosporidium toruloides IFO0880

Name: 16679
Annotation: K03016 RPB8, POLR2H DNA-directed RNA polymerases I, II, and III subunit RPABC3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03870: RNA_pol_Rpb8" amino acids 94 to 230 (137 residues), 163.9 bits, see alignment E=1.3e-52

Best Hits

Predicted SEED Role

"DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide (EC 2.7.7.6)" in subsystem RNA polymerase I or RNA polymerase II or RNA polymerase III (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>mRNA_8311 K03016 RPB8, POLR2H DNA-directed RNA polymerases I, II, and III subunit RPABC3 (Rhodosporidium toruloides IFO0880)
MSALWRTQQTLVCLHCLLSRRADEGCPSSSRSHPAARVLEHLRELHSLHCFARHPPRPRP
HPLSLPPPPRPDTASSRPNTMAAASTSSAIIFTDVFNVSDVDKDGKKFDRVSRIAAKSQN
HDMRMTLDINTDLIDLRQESEFSLALASTLHPDGVAKDAGATGGWRADIEGGLADDWDYV
MYGKVYKYDEGSGEEVTAYVSFGGLLMALTGVYRHMANLTVGEYVYLLLRPSKR