Protein Info for mRNA_8371 in Rhodosporidium toruloides IFO0880

Name: 16739
Annotation: HMMPfam-GPR1/FUN34/yaaH family-PF01184

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 29 to 54 (26 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 26 to 205 (180 residues), 49.3 bits, see alignment E=2.5e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>mRNA_8371 HMMPfam-GPR1/FUN34/yaaH family-PF01184 (Rhodosporidium toruloides IFO0880)
MALRSGNEYKLDELLAEVPKVRIFLRPIAPPAALGLAGFASSTWITASWIAGWWGDEKSP
GAFFPFVLFFGGVCQLIAGLMGFPARDTLVTVINTMWGAFWVAQGTAFYLIAAGVVPSHS
IYTHWPELASWFVPLAVFTWAGAIAAFARDLILALTLTFLATGSTIACCLFSFSEPGVRH
GIKAAAYFWILSSIFAAWRVFVYLQEEAWGPTNPVVKNAFPVFRFGTEKRAPLVVPGLGE
PGVKRGMPGVI