Protein Info for mRNA_8382 in Rhodosporidium toruloides IFO0880

Name: 16750
Annotation: K00799 GST, gst glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 32 to 96 (65 residues), 52.8 bits, E=1.1e-17
• PF13417: GST_N_3
  • amino acids 34 to 102 (69 residues), 83.8 bits, E=2.3e-27
• PF13409: GST_N_2
  • amino acids 34 to 97 (64 residues), 73.7 bits, E=3.1e-24
• PF00043: GST_C
  • amino acids 130 to 216 (87 residues), 25.1 bits, E=4.2e-09
• PF13410: GST_C_2
  • amino acids 167 to 210 (44 residues), 27.8 bits, 5.3e-10

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 44% identity to cnb:CNBM2220)

Predicted SEED Role

No annotation

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• pentachlorophenol degradation (5/10 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (255 amino acids)

>mRNA_8382 K00799 GST, gst glutathione S-transferase (Rhodosporidium toruloides IFO0880)
MPDKIDPPHATGAAEQTVQKHSSPHDLVFHAGWFCPFVQRVWIALEEKGIPYEYKEVNPY
KKEPHFLKINPKGLVPALEHDNKALYESLVLLEYLDDAFPDSAIRPRNPHELGLVRLACQ
QISNVVVPAFYRYVQAQEADKQKEGHEAFVKALREVHEQWFVVGSEWARGDKFGWVDCVL
GPWVARFTLLEKHRGFKPEDVGPEFKAWCDKLLDRPSVKATSSLPENYENVYRRYFENTA
ESEVAKATRKGEWLK