Protein Info for mRNA_8475 in Rhodosporidium toruloides IFO0880

Name: 16843
Annotation: K03113 EIF1, SUI1 translation initiation factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 PF01253: SUI1" amino acids 34 to 108 (75 residues), 95.1 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 48% identical to SUI1_PIMBR: Protein translation factor SUI1 homolog from Pimpinella brachycarpa

KEGG orthology group: K03113, translation initiation factor 1 (inferred from 64% identity to mgl:MGL_1052)

Predicted SEED Role

"Translation initiation factor SUI1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>mRNA_8475 K03113 EIF1, SUI1 translation initiation factor 1 (Rhodosporidium toruloides IFO0880)
MSSTLLNKPYDAFADEGADEEVVVETKSKKQQQSNHIHIRIQQRNGRKTITTLQGVPTEY
DLKKLLKAFKKEFACNGAIIEDEDLGKVIQLQGDQRTKIQEMLIEEGIEKETIKMHGF