Protein Info for mRNA_8489 in Rhodosporidium toruloides IFO0880

Name: 16857
Annotation: K17768 TOM70 mitochondrial import receptor subunit TOM70

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details PF00515: TPR_1" amino acids 151 to 183 (33 residues), 29.4 bits, see alignment (E = 4e-10) amino acids 351 to 384 (34 residues), 31.4 bits, see alignment (E = 9.8e-11) PF13432: TPR_16" amino acids 333 to 385 (53 residues), 21.6 bits, see alignment 2.2e-07 amino acids 357 to 411 (55 residues), 36.2 bits, see alignment 6e-12 amino acids 424 to 480 (57 residues), 32 bits, see alignment 1.3e-10 PF13429: TPR_15" amino acids 345 to 472 (128 residues), 29.9 bits, see alignment E=2.7e-10 PF13181: TPR_8" amino acids 351 to 384 (34 residues), 28 bits, see alignment (E = 1.2e-09) amino acids 385 to 417 (33 residues), 17.3 bits, see alignment (E = 3.4e-06) PF07719: TPR_2" amino acids 352 to 384 (33 residues), 27.4 bits, see alignment (E = 1.8e-09) PF13428: TPR_14" amino acids 353 to 393 (41 residues), 23.7 bits, see alignment 4.7e-08 PF13414: TPR_11" amino acids 360 to 396 (37 residues), 33.1 bits, see alignment 2.8e-11 amino acids 392 to 433 (42 residues), 26.9 bits, see alignment 2.5e-09 PF14559: TPR_19" amino acids 362 to 417 (56 residues), 26.2 bits, see alignment 7.8e-09 PF13431: TPR_17" amino acids 374 to 405 (32 residues), 23.9 bits, see alignment (E = 3e-08) amino acids 442 to 472 (31 residues), 23.3 bits, see alignment (E = 4.9e-08) PF13174: TPR_6" amino acids 424 to 452 (29 residues), 14.7 bits, see alignment (E = 3.2e-05)

Best Hits

Swiss-Prot: 41% identical to TOM70_SCHPO: Probable mitochondrial import receptor subunit tom70 (tom70) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 49% identity to mgl:MGL_1497)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (595 amino acids)

>mRNA_8489 K17768 TOM70 mitochondrial import receptor subunit TOM70 (Rhodosporidium toruloides IFO0880)
MASNAQAAQTTSSSLSLWFQQHRRAVLITAGVVALSAAGTLYYTQSNSQHARRAREQARD
AANKAADKAKKERKQKKAKQPGEGKPDAKSADDDDDPLKLTASDIEVMDPETRSKTALAL
KARGNKLYSAKQYQEAIDYYTKAIQCEEQAVFYSNRAACYTNLNQLDKVVEDCSNALRLD
PQYIKALNRRATAREQLGDAENLYLSLCDFTASAILDNFSTSSTTDSVERVMKQLATQKA
QDILSTREPRLPSPTFITAYLTAFRTRPPPSLPANPSQGDRTLQLAYDALDAKDFTHAFT
FFNESIKQGISTPAGKAEALNMRATFKFIMSDAEGALVDLDEATTVQPDSAQSWVKKASV
HMELGRPEDAMKDFDRALEIDPNNADVFYHRGQVFFITGEFDRAIAEYRRSSELDPAFIF
SHIQLAVAQYKSGSTEKALHQFRRLIEKNPESAEVYNYYGELLLDQQKFPEAVNAFDKSI
ELAKNKHLRNVLPMVNKALAIFQHRQDFATAESICREAVDIDPQCDVGVATLAQLLLQQN
KVHDAADMFAKSAEMARTEPELVNALTYENATRAQIAFLKNYPLQADRLGLSRTA