Protein Info for mRNA_27 in Rhodosporidium toruloides IFO0880

Name: 8395
Annotation: K00088 IMPDH, guaB IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 35 to 520 (486 residues), 443.8 bits, E=1e-136
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 35 to 496 (462 residues), 619.3 bits, E=2.1e-190
• PF00571: CBS
  • amino acids 122 to 169 (48 residues), 17.6 bits, 1.1e-06
  • amino acids 181 to 232 (52 residues), 21.3 bits, 7.7e-08
• PF01070: FMN_dh
  • amino acids 279 to 393 (115 residues), 43.4 bits, E=6.2e-15

Best Hits

Swiss-Prot: 71% identical to IMDH_CRYNJ: Inosine-5'-monophosphate dehydrogenase (CNA04240) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 71% identity to cne:CNA04240)

MetaCyc: 61% identical to inosine-5'-monophosphate dehydrogenase 1 monomer (Homo sapiens)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• purine nucleotides degradation II (aerobic) (11/11 steps found)
• purine nucleotides degradation I (plants) (11/12 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• adenosine nucleotides degradation I (8/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• ureide biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Protein Sequence (531 amino acids)

>mRNA_27 K00088 IMPDH, guaB IMP dehydrogenase (Rhodosporidium toruloides IFO0880)
MPFLDPKNALAHLETYTRGDGLSVRELMDSQKQGGLTYNDFLVLPGHIDFPASAVSLESR
VTKKTVIKTPFLSSPMDTVTETDMAIAMALLGGLGVIHHNLPPQMQADMVRAVKKFENGF
ITDPICLTPKNTVADVWAIKEKHGFCGIPITDSGKLGGKLLGIVTGRDIQFRPNSASLES
VMTQGADLVTGPAGITLEQANDILRDSKKGKLPLVDKEGRLVALLARSDLLKNKDYPLAS
KKPDSKQLLCAAAIGTRAPDRDRLRLLVEAGLDVVVLDSSQGNSVYQIDMIKWIKQEFPD
LEVIAGNVVTREQAASLIHAGADGLRVGMGSGSICITQEVTAVGRPQATAVFAVAEFARQ
FGVPVIADGGISNVGHIAKALALGASAVMMGGLLAGTTESPGEYFYNEGKRLKKYRGMGS
IDAMDAGTVKDHKKADEIDNAATSRYFSEGDAVRVAQGVAGAVQDKGSLRKFIPYLFAGL
QHSLQDMGTRSIAEMQDASFDNTLRFELRTASAQLEGGVHGLHSYEKRLFS