Protein Info for mRNA_43 in Rhodosporidium toruloides IFO0880

Name: 8411
Annotation: K05609 UCHL3, YUH1 ubiquitin carboxyl-terminal hydrolase L3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF01088: Peptidase_C12" amino acids 6 to 213 (208 residues), 191 bits, see alignment E=1.2e-60

Best Hits

Swiss-Prot: 36% identical to UCHL_DROME: Ubiquitin carboxyl-terminal hydrolase (Uch) from Drosophila melanogaster

KEGG orthology group: K05609, ubiquitin carboxyl-terminal hydrolase L3 [EC: 3.4.19.12] (inferred from 45% identity to hmg:100199848)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.4.19.12

Use Curated BLAST to search for 3.4.19.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>mRNA_43 K05609 UCHL3, YUH1 ubiquitin carboxyl-terminal hydrolase L3 (Rhodosporidium toruloides IFO0880)
MDDPRWLPLESNPESFNKWSASLGLDTSPPKGYHFTDIWGLDPELLQFVKQPVKAVLMLF
PVTPEYEKMRKEQDEKVLEEGVEGVEDVIYFKQTIANACGTFALLHTLANVDVPIKEGPL
TELFARCKDKTPLERAQLLTTAKELESVHEQAAQTGQTAAPALEDDTDLHFVTFVEHNGF
LIELDGRRNSPINHGKIEKGLLDDTVEVVKHIMELTQSIQFNLVALSPATEDD