Protein Info for mRNA_100 in Rhodosporidium toruloides IFO0880

Name: 8468
Annotation: K03686 dnaJ molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 PF00226: DnaJ" amino acids 20 to 81 (62 residues), 86 bits, see alignment E=2.3e-28 PF01556: DnaJ_C" amino acids 151 to 368 (218 residues), 132.3 bits, see alignment E=2.3e-42 PF00684: DnaJ_CXXCXGXG" amino acids 178 to 240 (63 residues), 35.2 bits, see alignment E=1.9e-12

Best Hits

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>mRNA_100 K03686 dnaJ molecular chaperone DnaJ (Rhodosporidium toruloides IFO0880)
MHSWQGQRSFHASSRQLAKNPYSVLGVGKDASTSEIKKAYYQLAKKYHPDSSKEPGAKEK
FVEIQEAYDTLSDDKKRADFDRFGSASQQPGFDSDAFARATSSFGGAGFGDFFGGGAGGA
SGADIFESLFGAFGRGGAAGPRQTQPVGDDIDVSISVPFIQAAKGTSKTIQISPVVDCHT
CHGSGLKEGMKKTTCGSCGGTGTRTFTIQSGFQMASTCAACGGSGSVAPPGSNCGTCAGV
GKVRERRSVEVKIPPGVDDGMRIRLDGKGDAPIGGKGRNGDLFVRINVQPSKVFTRQGSN
LYETVSVPFYTAILGGRAPVKTLERDVEVKVPQGTQPGEEMVLRGRGVKKLYKEEYGDLI
VRFNVSMPRSLTPIQRMILEQYVRETEEPGSSSTSPFTSSPSPDSPPSPPPSDAPTPQKP
RVDTDAPGFTQQARPPPEDAETGGKKPQWWASLGDDITSAPKREGKEGKEVEEEEVRHAK
EVFEEIAKEEVNNLEKEKAEKAKGKKGVKKEGEEGEDGHSLLGDLWKGAKGWFGSR