Protein Info for mRNA_110 in Rhodosporidium toruloides IFO0880

Name: 8478
Annotation: KOG3399 Predicted Yippee-type zinc-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF03226: Yippee-Mis18" amino acids 20 to 110 (91 residues), 61.5 bits, see alignment E=4.2e-21

Best Hits

Swiss-Prot: 55% identical to YIPL_ORYSJ: Putative yippee-like protein Os10g0369500 (Os10g0369500) from Oryza sativa subsp. japonica

KEGG orthology group: None (inferred from 60% identity to lbc:LACBIDRAFT_181316)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>mRNA_110 KOG3399 Predicted Yippee-type zinc-binding protein (Rhodosporidium toruloides IFO0880)
MGLKHLEYLAVPSTLTNGKVFGCRRCKTHLTTSEQIESKNFNGQHGRAYLFTNVVNICTG
PAEDRPMTTGLHTVRDVMCAKCGETLGWKYDKAYEANQKYKEGKFILERAMWTDVQ