Protein Info for mRNA_168 in Rhodosporidium toruloides IFO0880

Name: 8536
Annotation: K01598 PPCDC, coaC phosphopantothenoylcysteine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02441: Flavoprotein
  • amino acids 38 to 220 (183 residues), 181.3 bits, E=5.9e-58

Best Hits

KEGG orthology group: K01598, phosphopantothenoylcysteine decarboxylase [EC: 4.1.1.36] (inferred from 61% identity to lbc:LACBIDRAFT_182812)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (7/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (4/5 steps found)
• coenzyme A biosynthesis I (prokaryotic) (3/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (3/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.36

Protein Sequence (230 amino acids)

>mRNA_168 K01598 PPCDC, coaC phosphopantothenoylcysteine decarboxylase (Rhodosporidium toruloides IFO0880)
MDPTEDLRQTIARLLPNGLGAKGDEERNPVVFPARNLHVLLAVSGSVASIKAPLIVRELL
KYDKVDVQVVATKSATHFFSAAEIEKEYAHRVRVWTDADEWAGWNQIGDPVLHIELRRWA
DVVLVAPCSANTLAKITSGICDNILTSFLRALPTFVPVHLFPAMNTHMYSHPLTAKQLKM
VQEELGYKVHGPIGKKLACGDIGIGAMTEWSDIVQLVVDEYGLKHRDEAS