Protein Info for mRNA_171 in Rhodosporidium toruloides IFO0880

Name: 8539
Annotation: K03237 EIF2S1 translation initiation factor 2 subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00575: S1" amino acids 9 to 83 (75 residues), 50.6 bits, see alignment E=2e-17 PF07541: EIF_2_alpha" amino acids 122 to 232 (111 residues), 122.8 bits, see alignment E=8.3e-40

Best Hits

Swiss-Prot: 65% identical to IF2A_SCHPO: Eukaryotic translation initiation factor 2 subunit alpha (tif211) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 65% identity to uma:UM01463.1)

Predicted SEED Role

"Eukaryotic translation initiation factor 2 alpha subunit" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>mRNA_171 K03237 EIF2S1 translation initiation factor 2 subunit 1 (Rhodosporidium toruloides IFO0880)
MRYYENRFPEVDEVVMVQVKQIQEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRV
GRNEVVVVMRVDKEKGYIDLSKRRVSPEDVIKCEERYNKSKTVHTIVRHVAEKTGKEMDE
IMELVAWPLYKKYGHAFEAFKLSISEPETVFADMNIPEDIYSELRVNIARRLTPQPVKVR
ADIEVTNFSYNGILTIQEALAAGESLSTEEIPIKIRLVAPPLYVMVTNTTDKQGAIERLE
QAIEKIGEVIKREDGGFLNVKMKPKAVSETDDLELAALMDRVARENKEVSGDEDSDGE