Protein Info for mRNA_175 in Rhodosporidium toruloides IFO0880

Name: 8543
Annotation: KOG2533 Permease of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details amino acids 438 to 459 (22 residues), see Phobius details PF07690: MFS_1" amino acids 56 to 423 (368 residues), 130.1 bits, see alignment E=5e-42

Best Hits

KEGG orthology group: None (inferred from 55% identity to cci:CC1G_00265)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>mRNA_175 KOG2533 Permease of the major facilitator superfamily (Rhodosporidium toruloides IFO0880)
MSAPASTPELAKVSSKEQEVFAEHDERTLETGGTADRKRLERKLLWKLDARFCLFIILYI
LNYIDRQNASAARLKGFEKDLGLHGTQYATVLSILYVGYILTQIPSNIIVQKTGRPSLWL
PACMLTWGALSVATGAAKNYGQVIAIRFLLGIAESAFFPGALMTLASWYPKRELGQRITL
LYCGSLISNAFGPLIAAGILGRMEGAGGVRAWRWLFYIEGAITMAVAVISVFILPDFPHN
SRGFTAEEKELAQLRMTEDVGVKDETNVSTWTALKLALGDYRLWVFSLTLTAMVVGLSFN
AYFPTLTKTLGYSSEVSLLLCAPPFVWAAIVAYFVSRDSDKRQERYLHIVVPLVFGIVGA
IIAMTCRKSFGASYFALFLMASSYAGFVVFYAWTASTFARPAMTRSISLAFVNAFSQLGN
ISGSYVWPSKWAPYTKSYGIVIAMFAATIIGLTIIRFDLVRLNKKLAARDESEAKGQEHH
GLSATDYPAGFRYTL