Protein Info for mRNA_211 in Rhodosporidium toruloides IFO0880

Name: 8579
Annotation: K00432 gpx glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00255: GSHPx
  • amino acids 7 to 114 (108 residues), 131.8 bits, E=7.3e-43
• PF00578: AhpC-TSA
  • amino acids 10 to 141 (132 residues), 24 bits, E=3.1e-09

Best Hits

Swiss-Prot: 55% identical to GPX2_YEAST: Glutathione peroxidase-like peroxiredoxin 2 (GPX2) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 63% identity to uma:UM01784.1)

MetaCyc: 48% identical to hydroperoxy fatty acid reductase 1 (Synechocystis sp. PCC 6803)
RXN-13944 [EC: 1.11.1.22]; 1.11.1.- [EC: 1.11.1.22]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (2/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.22 or 1.11.1.9

Protein Sequence (165 amino acids)

>mRNA_211 K00432 gpx glutathione peroxidase (Rhodosporidium toruloides IFO0880)
MASVASFYELEAEKPSGDKIKFDDLKGKVVLVVNTATKCGFTYQFTGLEELNKKYKDQGL
VVLGFPSDQFGHQNPEDDETTGSVCQRNHGVTFPLLKKGDVNGSNAHPVFQYLKPKAKGI
LGERIAWNFTKFLVDKRGNVIHRYAPITKPDAIAADIEKALAESV