Protein Info for mRNA_224 in Rhodosporidium toruloides IFO0880

Name: 8592
Annotation: K07300 chaA, CAX Ca2+-H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 136 to 159 (24 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details amino acids 457 to 480 (24 residues), see Phobius details amino acids 486 to 507 (22 residues), see Phobius details amino acids 514 to 534 (21 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 164 to 322 (159 residues), 72 bits, see alignment E=2.8e-24 amino acids 389 to 532 (144 residues), 75.6 bits, see alignment E=2.2e-25

Best Hits

Predicted SEED Role

"Calcium/proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>mRNA_224 K07300 chaA, CAX Ca2+-H+ antiporter (Rhodosporidium toruloides IFO0880)
MSTLHPEMQGEHDERMDGRRSVSPDRMETGRGGGASSSSRDGDLSTTQSGSTAGQNEKHR
DTKEGKPARGVTMSDEVVPPAAGGSAYPPARASRSSRQGTRETSFEVPPLRQRLTELFVA
EHPIKNEPTVMQSLKAIVFASWFNVLLVFIPVGWALHFAKLNDTIIFVFTFLAILPLAGL
LSFGTEELALRVGQTLGGLLNATLGNATELIVAIIALVKGELQLVQSSLLGSILSNLLLV
LGMVFFVGGIRFSEQGFKDTAAQLNSSLLVISVIAILLPAGYNAAFSDNQTAEVERDRIL
KMSRGIAVILLVVYLAYLFFQLFTHKHLYAEGHVDPDDPIVRDGRQVWREHRVFRPAPSA
RRPRQIETGLEDEEEIEEEMPQLNKWVALGLLVVATVLIAVTSEFLVDSISGLTEQHPEI
SVEWVGLILLPIAGNVAEHVTAVTVSVHDKIDLSMGVAVGSSIQIALFVVPFITILAWII
KQPLSLLFDPFESIVLFLSVLIVNYTIQDGRSNWLEGFLLMSVYIILAVSFWYYPNGGSA
TLTG