Protein Info for mRNA_228 in Rhodosporidium toruloides IFO0880

Name: 8596
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 transmembrane" amino acids 111 to 133 (23 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 465 to 482 (18 residues), see Phobius details amino acids 494 to 518 (25 residues), see Phobius details amino acids 530 to 548 (19 residues), see Phobius details amino acids 554 to 575 (22 residues), see Phobius details PF07690: MFS_1" amino acids 117 to 540 (424 residues), 154.8 bits, see alignment E=4.5e-49 PF06609: TRI12" amino acids 134 to 296 (163 residues), 28.5 bits, see alignment E=8.5e-11 PF00083: Sugar_tr" amino acids 148 to 299 (152 residues), 46.2 bits, see alignment E=5e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (614 amino acids)

>mRNA_228 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MTADAPLADDPPVAASEPADAPQTHTALIASSSSSRSEHGSCAHTLHDSSDASGKQIAGK
GLGGNDEGGGESDNVVAGEEDESGMQPVRRRVTTGTVAPPPYTIHSHRMRWFIVSLVALA
GLFSPLSANIYFPVIPAVAQDLRVSVENINISVTVYMILQGVSPSFFGAICDVLGRRPTY
IATFLIYLGACAGLANTHTYWLLLVLRCVQAAGSASVIAIGSGSIGDIAPPSERGLFMSV
FGLGPMVGPCIGPIIGGLLAQRYGWQSLFWFLFAFGAFALLLIILFLPETLRSLVGNGSI
PARGINRSLVSVWQQRQRQRAGGERAREVDEASLKAKPRKKGWRDVRPFAPLKMFREKDV
FLTLTFNSICYTLFYCVTTSTGTTFKSTYNLNETSLGLCFIANGVGCLAATFVNGPRMTH
DYKVVQRQVERKKEENGEGGREKRRRKDQNDLSEFPIERARLRSMPYFFVALIASTIVYG
WVLDKGVHLSAPLIMQFIIGLSVTSIFNAVSTLLVDLYPGQSASATAANNLYRCICGAAG
TGFIEPLLNRLGAGWGFTMLSLINVCFVPLMILEWRYGMKWRLQRFERLKREKEREEEKA
REKGRELEKRREGH