Protein Info for mRNA_230 in Rhodosporidium toruloides IFO0880

Name: 8598
Annotation: K11254 H4 histone H4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF02969: TAF" amino acids 37 to 94 (58 residues), 23 bits, see alignment E=7.5e-09 PF15511: CENP-T_C" amino acids 38 to 99 (62 residues), 30.2 bits, see alignment E=4.2e-11

Best Hits

Swiss-Prot: 96% identical to H4_PHACH: Histone H4 (H4.1) from Phanerochaete chrysosporium

KEGG orthology group: K11254, histone H4 (inferred from 93% identity to mbr:MONBRDRAFT_16238)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>mRNA_230 K11254 H4 histone H4 (Rhodosporidium toruloides IFO0880)
MLMSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV
LKIFLENIIRDSVTYTEHAKRKTVTSLDVVYALKRAGKTLYGFGGHK