Protein Info for mRNA_233 in Rhodosporidium toruloides IFO0880

Name: 8601
Annotation: K06287 maf septum formation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR00172: septum formation protein Maf" amino acids 34 to 231 (198 residues), 146.6 bits, see alignment E=3.1e-47 PF02545: Maf" amino acids 35 to 233 (199 residues), 159.4 bits, see alignment E=3.8e-51

Best Hits

Swiss-Prot: 40% identical to NTPPA_SCHPO: dTTP/UTP pyrophosphatase (SPAC3G6.03c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K06287, septum formation protein (inferred from 40% identity to spo:SPAC3G6.03c)

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>mRNA_233 K06287 maf septum formation protein (Rhodosporidium toruloides IFO0880)
MALSEKAPLNPQKREDPVLPTALRLPVFNKLKGKHIVLASASPRRIEILRTFGLNPRVVP
STFPETLSHADFDDPAQYAVATGSAKAVEVYEQLVRDDPEDPPDLVIGADTVVILPGPDP
TILEKPRNESDQLNMLESYQGAKVQVVTGVTIVQPQIATPGYSCASLVVATNVIFADCSP
ELLQAYVECGEGLDRAGGFAVQGQGGLLVKRIEGDYNNVVGFPGQAFIEWLSQLTEEGTL
LELD