Protein Info for mRNA_240 in Rhodosporidium toruloides IFO0880

Name: 8608
Annotation: KOG0254 Predicted transporter (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 272 to 298 (27 residues), see Phobius details amino acids 310 to 334 (25 residues), see Phobius details amino acids 337 to 337 (1 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 2 to 376 (375 residues), 247.3 bits, see alignment E=3.1e-77 PF07690: MFS_1" amino acids 5 to 324 (320 residues), 53.6 bits, see alignment E=1.8e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>mRNA_240 KOG0254 Predicted transporter (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MTLPIYLAEISPAKFRGRIVASLVVLITGGQVLAYIVDAIFFPVTKGWRWMFGFGAVPAV
VQLLLSFSLPESPRFQLRHDRVASARKTIRLLNPTLSHGAVQRRIESIQAEVQGAKESDR
ADEAREGGVPLSLAKWKDWLQDWRNDIQEGRLGRLWRDRVSRRTLLVAAGLQFFQQATGF
NTLMYYSAKIIQLSGLGQPVAFAIFVALSNFLSTIVALRLIDRMGRRALLLRTLIGMLFG
MSLLAFSFVFIHLRADDAVQAAAAGQSGPSPWAFVAILAMNIFCISFALGIGNCAWVVQS
EVFNQDQRAVGNGIATAVNWSANLLISSTFLHLASAITPAGTFALYSVISLAGWIFTWRY
LPETKGLSLDEVRELFEREVGVHGTTAAPSAPTGGEASYHVVGEETSEEEEEERGTEATA
APKENRPESHEADKPIAGGGRDAHPD