Protein Info for mRNA_316 in Rhodosporidium toruloides IFO0880

Name: 8684
Annotation: K18802 DUG3 glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 51% identical to DUG3_YEAST: Probable glutamine amidotransferase DUG3 (DUG3) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K07008, glutamine amidotransferase (inferred from 58% identity to scm:SCHCODRAFT_255410)

MetaCyc: 51% identical to glutamine amidotransferase II (Saccharomyces cerevisiae)
RXN-12618 [EC: 3.4.19.13]

Predicted SEED Role

No annotation

MetaCyc Pathways

glutathione degradation (DUG pathway - yeast) (2/2 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
4-hydroxy-2-nonenal detoxification (1/4 steps found)
glutathione-mediated detoxification I (3/8 steps found)
glutathione-mediated detoxification II (1/9 steps found)
indole glucosinolate activation (intact plant cell) (3/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.19.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>mRNA_316 K18802 DUG3 glutamine amidotransferase (Rhodosporidium toruloides IFO0880)
MVQQDARQSFRRLKRFPAMCRLLVVKAEEPIQLSQLLTKPAHSIINQASDSRLRLDAGSI
NADGFGVGWYPTDEAPDSPGPCVFRSITPAWSNLNLHRLADKIKSCLVFAHVRASTTGAL
SEENTHPWTYGNLVWMHNGCISDFAKIKRRLQNDLSDEYFQVPQGNTDSEWAFAAFLQQL
SKLTDPKKATIPHAILRQAMLNTVAVLTAYTKDVGATEPSLMNFCVSDGTSVVATRYITS
ANEEAASLFFSTGSTFQEVEPGTFKMNKADKRERIVLIASEPLTFERADWVEIPSQSCIV
ITPRINLLRYPIVNEFFQPSATSHRADGFARAKGYRWARPQAVEAN