Protein Info for mRNA_328 in Rhodosporidium toruloides IFO0880

Name: 8696
Annotation: K02987 RP-S4e, RPS4 small subunit ribosomal protein S4e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF08071: RS4NT" amino acids 3 to 39 (37 residues), 61.9 bits, see alignment 1.2e-20 PF01479: S4" amino acids 44 to 90 (47 residues), 26.1 bits, see alignment 1.4e-09 PF00900: Ribosomal_S4e" amino acids 96 to 169 (74 residues), 126.6 bits, see alignment E=7.3e-41 PF00467: KOW" amino acids 178 to 210 (33 residues), 24.6 bits, see alignment 4.5e-09 PF16121: 40S_S4_C" amino acids 212 to 257 (46 residues), 84.6 bits, see alignment 7.3e-28

Best Hits

Swiss-Prot: 72% identical to RS4_YARLI: 40S ribosomal protein S4 (RPS4) from Yarrowia lipolytica (strain CLIB 122 / E 150)

KEGG orthology group: K02987, small subunit ribosomal protein S4e (inferred from 83% identity to cnb:CNBA6010)

Predicted SEED Role

"SSU ribosomal protein S4e" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>mRNA_328 K02987 RP-S4e, RPS4 small subunit ribosomal protein S4e (Rhodosporidium toruloides IFO0880)
MARGPKKHMSRLAAPKAWMLDKLGGAYAPKPSPGPHKQRECLPLSIFIRNRLKYALTGRE
VTLVVKQRLIKVDNKVRTDETYPAGFMDVISIEKSGEHFRLLYDVKGRFAIHRISEEEAS
YKLLKVKKVQLGAKGVPFIVTHDGRTIRYPDPAIKVNDTVKFDLVENKIVDHIKFEQGNL
CMLTGGRNQGRVGQIVHRERHQGGYDIVHVRDVLDREFATRLSNVFVIGAGAKALVSLPK
GKGVKLSIAEERDQRRHRLEKQRA