Protein Info for mRNA_331 in Rhodosporidium toruloides IFO0880

Name: 8699
Annotation: K03940 NDUFS7 NADH dehydrogenase (ubiquinone) Fe-S protein 7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 267 to 293 (27 residues), see Phobius details TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 122 to 250 (129 residues), 228.7 bits, see alignment E=1.2e-72 PF01058: Oxidored_q6" amino acids 147 to 250 (104 residues), 72.6 bits, see alignment E=1.4e-24

Best Hits

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>mRNA_331 K03940 NDUFS7 NADH dehydrogenase (ubiquinone) Fe-S protein 7 (Rhodosporidium toruloides IFO0880)
MARPSSPRLAPDLVALRHLAPSAHPQQCSRSGQASTRLAHQANLANSPPQPPTGLQPALR
QARPSAILARSIATTPARTASPSTEVSTPVNQVQASQAYDLAKVNSNQLSLETPRNGVEY
ALGTMDKIVNWARQGSMWPMTFGLACCAVEMMHMAAARYDQDRLGVVFRASPRQSDIMIV
AGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDLYVPG
CPPTAEALLCVAFAVVCSQESLLTRLIVSLSIPLLPAFASTAFPLALLAIAFHTSSYHLP
LHRSPSTTPACRPPRYPRLALALRLALHFDPARSRQFRPRLYAALDAYSTWLLSLFTDDS
VLFDLASRCARPPHPLPLLLLPLRHPPTSSHHYHTPTKTATACSSSNAK