Protein Info for mRNA_348 in Rhodosporidium toruloides IFO0880

Name: 8716
Annotation: KOG0085 G protein subunit Galphaq/Galphay, small G protein superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 215 to 233 (19 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details PF00503: G-alpha" amino acids 21 to 334 (314 residues), 269.9 bits, see alignment E=5.4e-84 PF00025: Arf" amino acids 182 to 267 (86 residues), 40 bits, see alignment E=4.5e-14

Best Hits

Swiss-Prot: 43% identical to GNAO_LOCMI: Guanine nucleotide-binding protein G(o) subunit alpha from Locusta migratoria

KEGG orthology group: K04640, guanine nucleotide binding protein (G protein), alpha, other (inferred from 52% identity to tml:GSTUM_00011103001)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>mRNA_348 KOG0085 G protein subunit Galphaq/Galphay, small G protein superfamily (Rhodosporidium toruloides IFO0880)
MGACGSTEAAGADQPSMEEVSRSKAIDRLLREEEQRQAREVKMLLLGPGSSGKSTILVIH
LSGFTPSELEAYRQQIFVNVRDGMRAVFQVMEEEGLDFADSGLAANRELVATARDLRDGE
PFPWPVLAAVQAMVADPVCRAVVARGSEVSVPESLPYFLLQLDRLADPCYQPTDQDVLRC
RQKTTGISETTFKNRHMEYRIFDVGGQRSERKKWIHCFENVTAILFLASLAGYDMQEALM
LFDSICNSQWFVRTSMILFLNKQDVFKERTSVSPISAFFPDYTGPDLDYHAGQEYFEARF
TRLNRSSSKEIYTHFTTAIDTSLVKVVMTSVYDIVLNNNLNDFIL