Protein Info for mRNA_440 in Rhodosporidium toruloides IFO0880

Name: 8808
Annotation: HMMPfam-G protein-coupled glucose receptor regulating Gpa2-PF11710,SUPERFAMILY--SSF81321

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 18 to 42 (25 residues), see Phobius details amino acids 65 to 91 (27 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details PF11710: Git3" amino acids 56 to 223 (168 residues), 28.3 bits, see alignment E=7.6e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>mRNA_440 HMMPfam-G protein-coupled glucose receptor regulating Gpa2-PF11710,SUPERFAMILY--SSF81321 (Rhodosporidium toruloides IFO0880)
MLDTYWVPLGDKRAGMHAVAIAATISLSLIVLLGSWIAWLLYRYYSKPASERVDHETRAI
KFLASSHGVLFLSLITGDLLQGIGFAMNYGWITRNALPSSLHPTPLCTAQAVFIQAGDLG
SAFSSLVICINLFFVLVFKITPSMKWIWGILAVEWVGVAVMTFAGPLARRGAEVPFYGPA
GGWCWMNTPYQRERLYLHYLWVFLVAFFDLLFYSIIAIYVAWQRRSLSQQQVNGPAKVWR
IMMLFPLVYIVTILPLSIYRLAYMTGHKLPIHYALGAGFIFTLSGAANCCIYAFTRKIVS
LDGIGGALRRGSGSGSFGKSIDKLSHLPRPSISFASSSHGRKDSLPPTFSSPFTLLNSAR
RKSSSATATSTTGALSGIRVEVETNVHGRSPSSFGDGAAQTGLFDSPPLTPLSPRFAGSG
RLQSYQLRFDGALGGGREEEGTRKSVERPFARLARRESEDDQTLAKEDELLVEDLDEEDR
RRRALSGASLGENLV