Protein Info for mRNA_476 in Rhodosporidium toruloides IFO0880

Name: 8844
Annotation: K02951 RP-S12e, RPS12 small subunit ribosomal protein S12e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF01248: Ribosomal_L7Ae" amino acids 33 to 127 (95 residues), 93.8 bits, see alignment E=2.2e-31

Best Hits

Swiss-Prot: 63% identical to RS12B_SCHPO: 40S ribosomal protein S12-B (rps1202) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02951, small subunit ribosomal protein S12e (inferred from 76% identity to scm:SCHCODRAFT_81141)

Predicted SEED Role

"SSU ribosomal protein S12e"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>mRNA_476 K02951 RP-S12e, RPS12 small subunit ribosomal protein S12e (Rhodosporidium toruloides IFO0880)
MSDNGSETPVVADVEEVQVQETEAPKGKMSVEDALKEVLKKALVHDGLARGLRECAKALD
KRQAHLCVLNESCTEGEYVKLIEALCAEHKINLIKISDPKLLGEWAGLCKLDKDGIPRKV
VGCSCVVVKDYGQESEALSVLLEYFQSR