Protein Info for mRNA_501 in Rhodosporidium toruloides IFO0880

Name: 8869
Annotation: K11338 RUVBL2, RVB2, INO80J RuvB-like protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF06068: TIP49" amino acids 18 to 359 (342 residues), 520.8 bits, see alignment E=4.8e-160 PF03796: DnaB_C" amino acids 64 to 193 (130 residues), 25.5 bits, see alignment E=2.1e-09 PF00004: AAA" amino acids 71 to 121 (51 residues), 24.3 bits, see alignment 9.5e-09 PF17856: TIP49_C" amino acids 367 to 432 (66 residues), 87.5 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 77% identical to RUVB2_USTMA: RuvB-like helicase 2 (RVB2) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: K11338, RuvB-like protein 2 [EC: 3.6.4.12] (inferred from 77% identity to uma:UM04226.1)

Predicted SEED Role

"TBP-interacting protein TIP49"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>mRNA_501 K11338 RUVBL2, RVB2, INO80J RuvB-like protein 2 (Rhodosporidium toruloides IFO0880)
MQGIQTTTSEREQTRVERIGAHSHIRGLGLDPTTLEPRGNSQGMVGQGKARKAAGVILKM
VKEGRIAGRAVLMAGPPSSGKTAIAMGMAQSLGSDVPFTMISASEIFSLEMSKTEALTQA
FRRSIGVRIKEESEIIEGEVVEIQIDRSLTGASKTGKITMKTTDMETVYDLGNKMIDALS
KEKVIAGDVIVIDKSTGKISKLGRSFTRARDYDAMGADTKFVQCPEGELQVRKEVVHTVS
LHEIDVINSRTQGFLALFAGDTGEIKAELRDQINNKVSDWREEGKAEIVPGVLFIDEVHM
LDIECFSFLNRALETELAPIVIMASNRGITRIRGTKYKSPHGIPIDLLDRALIISTGAYL
ADDIKEILSIRAQEEDVSLAPAALEILTKIGSETSLRYAIQLITLSNLVARRRKAAQVDV
PDVRRVYTLFLDEKRSVQFLKEQNSLLIGEDGQIGGGAGVDAMEVA