Protein Info for mRNA_546 in Rhodosporidium toruloides IFO0880

Name: 8914
Annotation: K00799 GST, gst glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 7 to 81 (75 residues), 49.6 bits, E=1.3e-16
• PF13417: GST_N_3
  • amino acids 15 to 85 (71 residues), 34.7 bits, E=6e-12
• PF13409: GST_N_2
  • amino acids 15 to 80 (66 residues), 33.8 bits, E=1e-11
• PF14497: GST_C_3
  • amino acids 148 to 223 (76 residues), 34.3 bits, E=7e-12
• PF13410: GST_C_2
  • amino acids 151 to 209 (59 residues), 25.9 bits, E=2.4e-09
• PF00043: GST_C
  • amino acids 152 to 214 (63 residues), 40.7 bits, E=6.7e-14

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 50% identity to hse:Hsero_1688)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• pentachlorophenol degradation (5/10 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (234 amino acids)

>mRNA_546 K00799 GST, gst glutathione S-transferase (Rhodosporidium toruloides IFO0880)
MAAKITVHWLEDSRAQRILWLLEELGLDYEVKRYSRDPKTLLAPKELADVHPLGKSPVVT
IVEDGKTLTLAESGAIVEFIVERYGSNLSIPASSSDMQARADYLYWLHWAEGSGMLPLMF
SIVFAQLPKQGPWLAKPLLNGVSYGAMSQFVLPRLKENFRFIEQSLAGKDYFAGGKLTGA
DIMMSFIAEGLESSPLPNDKYPNIFRWYNSMLERTAYKKALEKGGKNDLGRFTR